PDB entry 1owt

View 1owt on RCSB PDB site
Description: Structure of the Alzheimer's disease amyloid precursor protein copper binding domain
Class: apoptosis
Keywords: beta-alpha-beta-beta, APOPTOSIS
Deposited on 2003-03-30, released 2003-05-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amyloid beta a4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: APP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1owta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1owtA (A:)
sdallvpdkckflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgve
fvccpl