PDB entry 1ows

View 1ows on RCSB PDB site
Description: Crystal structure of a C49 Phospholipase A2 from Indian cobra reveals carbohydrate binding in the hydrophobic channel
Class: hydrolase
Keywords: Phospholipase, Enzyme, Phospholipids, HYDROLASE
Deposited on 2003-03-30, released 2003-05-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Naja naja [TaxId:35670]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1owsa_
  • Chain 'B':
    Compound: phospholipase a2
    Species: Naja naja [TaxId:35670]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1owsb_
  • Heterogens: NAG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1owsA (A:)
ntyqfrnmiectvpsrswwdfadygcycgcgsgtptddldrccqvhcncyrqageisgcr
pkfktytyqcsggtltckgnnnacaasscdcdrlaaicfagapyndnnynidlkarcn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1owsB (B:)
nikqfnnmiectvparswwdfadygcycgsgsgsptddldrccqthdncygagggstgca
pksrtytyqcsqgtltcsgensacaattcdcdrlaaicfagapyndtnynidlksrcq