PDB entry 1owr

View 1owr on RCSB PDB site
Description: crystal structure of human nfat1 bound monomerically to DNA
Class: transcription/DNA
Keywords: beta barrel, protein-DNA complex, double helix, binary, monomer, pseudo-continuous, transcription/DNA complex
Deposited on 2003-03-29, released 2004-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.241
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NFAT1 Monomeric Binding Site, Plus Strand
    Species: synthetic, synthetic
  • Chain 'B':
    Compound: NFAT1 Monomeric Binding Site, Minus Strand
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: NFAT1 Monomeric Binding Site, Plus Strand
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: NFAT1 Monomeric Binding Site, Minus Strand
    Species: synthetic, synthetic
  • Chain 'E':
    Compound: NFAT1 Monomeric Binding Site, Plus Strand
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: NFAT1 Monomeric Binding Site, Minus Strand
    Species: synthetic, synthetic
  • Chain 'G':
    Compound: NFAT1 Monomeric Binding Site, Plus Strand
    Species: synthetic, synthetic
  • Chain 'H':
    Compound: NFAT1 Monomeric Binding Site, Minus Strand
    Species: synthetic, synthetic
  • Chain 'M':
    Compound: Nuclear factor of activated T-cells, cytoplasmic 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NFATC2 OR NFAT1 OR NFATP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13469 (1-283)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1owrm1, d1owrm2, d1owrm3
  • Chain 'N':
    Compound: Nuclear factor of activated T-cells, cytoplasmic 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NFATC2 OR NFAT1 OR NFATP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13469 (1-283)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1owrn1, d1owrn2, d1owrn3
  • Chain 'P':
    Compound: Nuclear factor of activated T-cells, cytoplasmic 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NFATC2 OR NFAT1 OR NFATP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13469 (1-283)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1owrp1, d1owrp2, d1owrp3
  • Chain 'Q':
    Compound: Nuclear factor of activated T-cells, cytoplasmic 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NFATC2 OR NFAT1 OR NFATP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13469 (1-283)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1owrq1, d1owrq2, d1owrq3

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1owrM (M:)
    vplewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkpl
    glqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratid
    cagilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqrsa
    helpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksq
    pnmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1owrN (N:)
    vplewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkpl
    glqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratid
    cagilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqrsa
    helpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksq
    pnmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1owrP (P:)
    vplewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkpl
    glqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratid
    cagilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqrsa
    helpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksq
    pnmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1owrQ (Q:)
    vplewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkpl
    glqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratid
    cagilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqrsa
    helpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksq
    pnmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv