PDB entry 1owp

View 1owp on RCSB PDB site
Description: DATA6:photoreduced DNA pholyase / received X-rays dose 4.8 exp15 photons/mm2
Class: lyase
Keywords: DNA repair, flavin enzyme, Photoreactivating enzyme, lyase
Deposited on 2003-03-28, released 2004-04-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.206
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Deoxyribodipyrimidine photolyase
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:269084]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1owpa1, d1owpa2
  • Heterogens: PO4, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1owpA (A:)
    maapilfwhrrdlrlsdniglaaaraqsaqliglfcldpqilqsadmaparvaylqgclq
    elqqryqqagsrllllqgdpqhlipqlaqqlqaeavywnqdiepygrdrdgqvaaalkta
    giravqlwdqllhspdqilsgsgnpysvygpfwknwqaqpkptpvatptelvdlspeqlt
    aiaplllselptlkqlgfdwdggfpvepgetaaiarlqefcdraiadydpqrnfpaeagt
    sglspalkfgaigirqawqaasaahalsrsdearnsirvwqqelawrefyqhalyhfpsl
    adgpyrslwqqfpwenrealftawtqaqtgypivdaamrqltetgwmhnrcrmivasflt
    kdliidwrrgeqffmqhlvdgdlaannggwqwsassgmdpkplrifnpasqakkfdatat
    yikrwlpelrhvhpkdlisgeitpierrgypapivnhnlrqkqfkalynqlkaaiaepea
    epds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1owpA (A:)
    aapilfwhrrdlrlsdniglaaaraqsaqliglfcldpqilqsadmaparvaylqgclqe
    lqqryqqagsrllllqgdpqhlipqlaqqlqaeavywnqdiepygrdrdgqvaaalktag
    iravqlwdqllhspdqilsgsgnpysvygpfwknwqaqpkptpvatptelvdlspeqlta
    iaplllselptlkqlgfdwdggfpvepgetaaiarlqefcdraiadydpqrnfpaeagts
    glspalkfgaigirqawqaasaahalsrsdearnsirvwqqelawrefyqhalyhfpsla
    dgpyrslwqqfpwenrealftawtqaqtgypivdaamrqltetgwmhnrcrmivasfltk
    dliidwrrgeqffmqhlvdgdlaannggwqwsassgmdpkplrifnpasqakkfdataty
    ikrwlpelrhvhpkdlisgeitpierrgypapivnhnlrqkqfkalynqlkaai