PDB entry 1owk

View 1owk on RCSB PDB site
Description: Substituted 2-Naphthamidine Inhibitors of Urokinase
Class: hydrolase
Keywords: Plasminogen activation, Hydrolase, Serine protease, Glycoprotein, Kringle, EGF-like domain
Deposited on 2003-03-28, released 2003-09-30
The last revision prior to the SCOP 1.75 freeze date was dated 2004-01-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.211
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urokinase-type plasminogen activator
    Species: HOMO SAPIENS
    Gene: PLAU
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1owka_
  • Heterogens: 303, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1owkA (A:)
    iiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfidypkkedyivy
    lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
    clpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
    mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
    irsht