PDB entry 1owj

View 1owj on RCSB PDB site
Description: Substituted 2-Naphthamidine Inhibitors of Urokinase
Class: hydrolase
Keywords: Plasminogen activation, Hydrolase, Serine protease, Glycoprotein, Kringle, EGF-like domain
Deposited on 2003-03-28, released 2003-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urokinase-type plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Gene: PLAU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1owja_
  • Heterogens: 155

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1owjA (A:)
iiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
clpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irsht