PDB entry 1owh

View 1owh on RCSB PDB site
Description: Substituted 2-Naphthamidine Inhibitors of Urokinase
Class: hydrolase
Keywords: Plasminogen activation, Hydrolase, Serine protease, Glycoprotein, Kringle, EGF-like domain
Deposited on 2003-03-28, released 2003-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urokinase-type plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Gene: PLAU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00749 (0-231)
      • conflict (143)
    Domains in SCOPe 2.07: d1owha_
  • Heterogens: SO4, 239, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1owhA (A:)
iiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
clpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irsht