PDB entry 1owg

View 1owg on RCSB PDB site
Description: Crystal structure of WT IHF complexed with an altered H' site (T44A)
Class: transcription/DNA
Keywords: protein-DNA recognition, indirect readout, IHF, DNA bending, minor groove, TRANSCRIPTION/DNA COMPLEX
Deposited on 2003-03-28, released 2003-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.226
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integration host factor alpha-subunit
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1owga_
  • Chain 'B':
    Compound: Integration host factor beta-subunit
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1owgb_
  • Chain 'C':
    Compound: Phage lambda H' site
  • Chain 'D':
    Compound: 5'-d(*gp*gp*cp*cp*ap*ap*ap*ap*ap*ap*gp*cp*ap*tp*t)-3'
  • Chain 'E':
    Compound: 5'-d(*gp*cp*tp*tp*ap*tp*cp*ap*ap*tp*tp*tp*gp*tp*ap*gp*cp*ap*cp*c)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1owgA (A:)
maltkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqr
pgrnpktgedipitarrvvtfrpgqklksrvenaspkde

    Sequence, based on observed residues (ATOM records): (download) 
    >1owgA (A:)
altkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqrp
grnpktgedipitarrvvtfrpgqklksrvenaspk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1owgB (B:)
mtkselierlatqqshipaktvedavkemlehmastlaqgerieirgfgsfslhyraprt
grnpktgdkvelegkyvphfkpgkelrdraniyg

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.