PDB entry 1owf

View 1owf on RCSB PDB site
Description: Crystal structure of a mutant IHF (BetaE44A) complexed with the native H' Site
Class: transcription/DNA
Keywords: protein-DNA recognition, indirect readout, IHF, DNA bending, minor groove, TRANSCRIPTION/DNA COMPLEX
Deposited on 2003-03-28, released 2003-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.232
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integration host factor alpha-subunit
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1owfa_
  • Chain 'B':
    Compound: Integration host factor beta-subunit
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6Y1 (0-93)
      • engineered (43)
    Domains in SCOPe 2.07: d1owfb_
  • Chain 'C':
    Compound: Phage lambda H' site
  • Chain 'D':
    Compound: 5'-d(*gp*gp*cp*cp*ap*ap*ap*ap*ap*ap*gp*cp*ap*tp*t)-3'
  • Chain 'E':
    Compound: 5'-d(*gp*cp*tp*tp*ap*tp*cp*ap*ap*tp*tp*tp*gp*tp*tp*gp*cp*ap*cp*c)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1owfA (A:)
    maltkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqr
    pgrnpktgedipitarrvvtfrpgqklksrvenaspkde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1owfA (A:)
    altkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqrp
    grnpktgedipitarrvvtfrpgqklksrvenaspk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1owfB (B:)
    mtkselierlatqqshipaktvedavkemlehmastlaqgeriairgfgsfslhyraprt
    grnpktgdkvelegkyvphfkpgkelrdraniyg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.