PDB entry 1owe

View 1owe on RCSB PDB site
Description: Substituted 2-Naphthamidine inhibitors of urokinase
Class: hydrolase
Keywords: Plasminogen activation, Hydrolase, Serine protease, Glycoprotein, Kringle, EGF-like domain
Deposited on 2003-03-28, released 2003-09-30
The last revision prior to the SCOP 1.75 freeze date was dated 2004-01-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.21
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urokinase-type plasminogen activator
    Species: HOMO SAPIENS
    Gene: PLAU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00749 (0-244)
      • conflict (143)
    Domains in SCOP 1.75: d1owea_
  • Heterogens: SO4, 675, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oweA (A:)
    iiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfidypkkedyivy
    lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
    clpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
    mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
    irsht