PDB entry 1owa

View 1owa on RCSB PDB site
Description: Solution Structural Studies on Human Erythrocyte Alpha Spectrin N Terminal Tetramerization Domain
Class: cytokine
Keywords: triple helical bundle, CYTOKINE
Deposited on 2003-03-28, released 2004-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spectrin alpha chain, erythrocyte
    Species: Homo sapiens [TaxId:9606]
    Gene: SPTA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1owaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1owaA (A:)
    meqfpketvvessgpkvletaeeiqerrqevltryqsfkervaergqkledsyhlqvfkr
    daddlgkwimekvniltdksyedptniqgkyqkhqsleaevqtksrlmselektreerft
    mghsaheetkahieelrhlwdllleltlekgdqllr