PDB entry 1owa

View 1owa on RCSB PDB site
Description: Solution Structural Studies on Human Erythrocyte Alpha Spectrin N Terminal Tetramerization Domain
Deposited on 2003-03-28, released 2004-03-30
The last revision prior to the SCOP 1.71 freeze date was dated 2004-03-30, with a file datestamp of 2004-03-30.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1owaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1owaA (A:)
    meqfpketvvessgpkvletaeeiqerrqevltryqsfkervaergqkledsyhlqvfkr
    daddlgkwimekvniltdksyedptniqgkyqkhqsleaevqtksrlmselektreerft
    mghsaheetkahieelrhlwdllleltlekgdqllr