PDB entry 1ow5

View 1ow5 on RCSB PDB site
Description: NMR structure of the Saccharomyces cerevisiae SAM (Sterile Alpha Motif) domain
Class: transferase
Keywords: MAP kinase, MAPKKK, SAM domain, Pointed domain, SCM domain, Ste50 regulator, TRANSFERASE
Deposited on 2003-03-28, released 2004-04-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase STE11
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: Ste11p
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ow5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ow5A (A:)
    ghhhhhhgdektndlpfvqlfleeigctqyldsfiqcnlvteeeikyldkdilialgvnk
    igdrlkilrksksfqrdkrieqvnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ow5A (A:)
    pfvqlfleeigctqyldsfiqcnlvteeeikyldkdilialgvnkigdrlkilrksksfq