PDB entry 1ow4

View 1ow4 on RCSB PDB site
Description: Crystal structure of a pheromone binding protein from the cockroach Leucophaea maderae in complex with the fluorescent reporter ANS (1-anilinonaphtalene-8-sulfonic acid),
Class: transport protein
Keywords: Pheromone Binding Protein, ligand 8-anilino-1-naphtalenesulfonic acid, transport protein
Deposited on 2003-03-28, released 2003-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.176
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pheromone binding protein
    Species: Leucophaea maderae [TaxId:6988]
    Gene: Pheromone Binding Protein (PBP)
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8MTC1 (Start-128)
      • cloning artifact (9-10)
    Domains in SCOPe 2.07: d1ow4a1, d1ow4a2
  • Chain 'B':
    Compound: pheromone binding protein
    Species: Leucophaea maderae [TaxId:6988]
    Gene: Pheromone Binding Protein (PBP)
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8MTC1 (Start-128)
      • cloning artifact (10)
    Domains in SCOPe 2.07: d1ow4b1, d1ow4b2
  • Heterogens: 2AN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ow4A (A:)
    mdiginsdpnsstqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacal
    dkvglispegaiytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdlikn
    ftdcvrnsy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ow4A (A:)
    nsstqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispe
    gaiytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrnsy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ow4B (B:)
    mdiginsdpnsstqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacal
    dkvglispegaiytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdlikn
    ftdcvrnsy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ow4B (B:)
    sstqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispeg
    aiytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrnsy