PDB entry 1ow4

View 1ow4 on RCSB PDB site
Description: Crystal structure of a pheromone binding protein from the cockroach Leucophaea maderae in complex with the fluorescent reporter ANS (1-anilinonaphtalene-8-sulfonic acid),
Deposited on 2003-03-28, released 2003-08-05
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-19, with a file datestamp of 2003-08-19.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.176
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ow4a_
  • Chain 'B':
    Domains in SCOP 1.67: d1ow4b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ow4A (A:)
    mdiginsdpnsstqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacal
    dkvglispegaiytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdlikn
    ftdcvrnsy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ow4A (A:)
    nsstqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispe
    gaiytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrnsy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ow4B (B:)
    mdiginsdpnsstqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacal
    dkvglispegaiytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdlikn
    ftdcvrnsy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ow4B (B:)
    sstqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispeg
    aiytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrnsy