PDB entry 1ow1

View 1ow1 on RCSB PDB site
Description: Crystal structure of the SPOC domain of the human transcriptional corepressor, SHARP.
Class: transcription
Keywords: beta-alpha-barrel, SPOC domain,, TRANSCRIPTION
Deposited on 2003-03-28, released 2003-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.214
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SMART/HDAC1 associated repressor protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ow1a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ow1A (A:)
    glvlphtefqpapkqdssphltsqrpvdmvqllkkypivwqgllalkndtaavqlhfvsg
    nnvlahrslplseggpplriaqrmrleatqlegvarrmtvetdyclllalpcgrdqedvv
    sqteslkaafitylqakqaagiinvpnpgsnqpayvlqifppcefseshlsrlapdllas
    isnisphlmiviasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ow1A (A:)
    pvdmvqllkkypivwqgllalkndtaavqlhfvsgnnvlahrslplspplriaqrmrlea
    tqlegvarrmtvetdyclllalpcgrdqedvvsqteslkaafitylqakqaagiinvpnp
    gsnqpayvlqifppcefseshlsrlapdllasisnisphlmiviasv