PDB entry 1ow0

View 1ow0 on RCSB PDB site
Description: Crystal structure of human FcaRI bound to IgA1-Fc
Deposited on 2003-03-27, released 2003-05-27
The last revision prior to the SCOP 1.65 freeze date was dated 2003-06-24, with a file datestamp of 2003-06-24.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.252
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ow0A (A:)
    achprlslhrpaledlllgseanltctltglrdasgvtftwtpssgksavqgpperdlcg
    cysvssvlpgcaepwnhgktftctaaypesktpltatlsksgntfrpevhllpppseela
    lnelvtltclargfspkdvlvrwlqgsqelprekyltwasrqepsqgtttfavtsilrva
    aedwkkgdtfscmvghealplaftqktidrlagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ow0A (A:)
    chprlslhrpaledlllgseanltctltglrdasgvtftwtpssgksavqgpperdlcgc
    ysvssvlpgcaepwnhgktftctaaypesktpltatlsksgntfrpevhllpppseelal
    nelvtltclargfspkdvlvrwlqgsqelprekyltwasrqepsqgtttfavtsilrvaa
    edwkkgdtfscmvghealplaftqktidr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ow0B (B:)
    achprlslhrpaledlllgseanltctltglrdasgvtftwtpssgksavqgpperdlcg
    cysvssvlpgcaepwnhgktftctaaypesktpltatlsksgntfrpevhllpppseela
    lnelvtltclargfspkdvlvrwlqgsqelprekyltwasrqepsqgtttfavtsilrva
    aedwkkgdtfscmvghealplaftqktidrlagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ow0B (B:)
    chprlslhrpaledlllgseanltctltglrdasgvtftwtpssgksavqgpperdlcgc
    ysvssvlpgcaepwnhgktftctaaypesktpltatlsksgntfrpevhllpppseelal
    nelvtltclargfspkdvlvrwlqgsqelprekyltwasrqepsqgtttfavtsilrvaa
    edwkkgdtfscmvghealplaftqktidr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ow0C (C:)
    qegdfpmpfisaksspvipldgsvkiqcqaireayltqlmiiknstyreigrrlkfwnet
    dpefvidhmdankagryqcqyrighyrfrysdtlelvvtglygkpflsadrglvlmpgen
    isltcssahipfdrfslakegelslpqhqsgehpanfslgpvdlnvsgiyrcygwynrsp
    ylwsfpsnalelvvtaidgrahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ow0C (C:)
    pmpfisaksspvipldgsvkiqcqaireayltqlmiiknstyreigrrlkfwnetdpefv
    idhmdankagryqcqyrighyrfrysdtlelvvtglygkpflsadrglvlmpgenisltc
    ssahipfdrfslakegelslpqhqsgehpanfslgpvdlnvsgiyrcygwynrspylwsf
    psnalelvvt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ow0D (D:)
    qegdfpmpfisaksspvipldgsvkiqcqaireayltqlmiiknstyreigrrlkfwnet
    dpefvidhmdankagryqcqyrighyrfrysdtlelvvtglygkpflsadrglvlmpgen
    isltcssahipfdrfslakegelslpqhqsgehpanfslgpvdlnvsgiyrcygwynrsp
    ylwsfpsnalelvvtaidgrahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ow0D (D:)
    pmpfisaksspvipldgsvkiqcqaireayltqlmiiknstyreigrrlkfwnetdpefv
    idhmdankagryqcqyrighyrfrysdtlelvvtglygkpflsadrglvlmpgenisltc
    ssahipfdrfslakegelslpqhqsgehpanfslgpvdlnvsgiyrcygwynrspylwsf
    psnalelvvt