PDB entry 1ovy

View 1ovy on RCSB PDB site
Description: Solution Structure of Ribosomal Protein L18 from Bacillus stearothermophilus
Class: Ribosome
Keywords: Ribosomal Protein, Ribosome
Deposited on 2003-03-27, released 2004-02-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L18
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: RPLR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ovya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ovyA (A:)
    mitkvdrnavrkkrharirkkifgtterprlsvfrsnkhiyaqiiddtksativsastld
    kefgldstnnieaakkvgelvakralekgikqvvfdrggylyhgrvkaladaareaglef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ovyA (A:)
    gtterprlsvfrsnkhiyaqiiddtksativsastldkefgldstnnieaakkvgelvak
    ralekgikqvvfdrggylyhgrvkaladaareaglef