PDB entry 1ovx

View 1ovx on RCSB PDB site
Description: NMR structure of the E. coli ClpX chaperone zinc binding domain dimer
Class: metal binding protein
Keywords: treble clef zinc finger, homodimer, METAL BINDING PROTEIN
Deposited on 2003-03-27, released 2003-12-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease ATP-binding subunit clpX
    Species: Escherichia coli [TaxId:83333]
    Gene: Clpx
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ovxa_
  • Chain 'B':
    Compound: ATP-dependent Clp protease ATP-binding subunit clpX
    Species: Escherichia coli [TaxId:83333]
    Gene: Clpx
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ovxb_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ovxA (A:)
ghhhhhhtdkrkdgsgkllycsfcgksqhevrkliagpsvyicdecvdlcndiireeike
vaphrer

    Sequence, based on observed residues (ATOM records): (download) 
    >1ovxA (A:)
llycsfcgksqhevrkliagpsvyicdecvdlcndiir

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1ovxB (B:)
ghhhhhhtdkrkdgsgkllycsfcgksqhevrkliagpsvyicdecvdlcndiireeike
vaphrer

    Sequence, based on observed residues (ATOM records): (download) 
    >1ovxB (B:)
llycsfcgksqhevrkliagpsvyicdecvdlcndiir