PDB entry 1ovt

View 1ovt on RCSB PDB site
Description: refined crystallographic structure of hen ovotransferrin at 2.4 angstroms resolution
Class: iron transport protein
Keywords: iron transport protein
Deposited on 1995-04-28, released 1995-09-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.171
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ovotransferrin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1ovta1, d1ovta2
  • Heterogens: FE, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ovtA (A:)
    appksvirwctisspeekkcnnlrdltqqerisltcvqkatyldcikaianneadaisld
    ggqafeaglapyklkpiaaevyehtegsttsyyavavvkkgteftvndlqgktschtglg
    rsagwnipigtllhrgaiewegiesgsveqavakffsascvpgatieqklcrqckgdpkt
    kcarnapysgysgafhclkdgkgdvafvkhttvnenapdqkdeyellcldgsrqpvdnyk
    tcnwarvaahavvarddnkvediwsflskaqsdfgvdtksdfhlfgppgkkdpvlkdllf
    kdsaimlkrvpslmdsqlylgfeyysaiqsmrkdqltpsprenriqwcavgkdekskcdr
    wsvvsngdvectvvdetkdciikimkgeadavaldgglvytagvcglvpvmaeryddesq
    csktderpasyfavavarkdsnvnwnnlkgkkschtavgrtagwvipmglihnrtgtcnf
    deyfsegcapgsppnsrlcqlcqgsggippekcvasshekyfgytgalrclvekgdvafi
    qhstveentggknkadwaknlqmddfellctdgrranvmdyrecnlaevpthavvvrpek
    ankirdllerqekrfgvngsekskfmmfesqnkdllfkdltkclfkvregttykeflgdk
    fytvisslktcnpsdilqmcsflegk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ovtA (A:)
    svirwctisspeekkcnnlrdltqqerisltcvqkatyldcikaianneadaisldggqa
    feaglapyklkpiaaevyehtegsttsyyavavvkkgteftvndlqgktschtglgrsag
    wnipigtllhrgaiewegiesgsveqavakffsascvpgatieqklcrqckgdpktkcar
    napysgysgafhclkdgkgdvafvkhttvnenapdqkdeyellcldgsrqpvdnyktcnw
    arvaahavvarddnkvediwsflskaqsdfgvdtksdfhlfgppgkkdpvlkdllfkdsa
    imlkrvpslmdsqlylgfeyysaiqsmrkdqltpsprenriqwcavgkdekskcdrwsvv
    sngdvectvvdetkdciikimkgeadavaldgglvytagvcglvpvmaeryddesqcskt
    derpasyfavavarkdsnvnwnnlkgkkschtavgrtagwvipmglihnrtgtcnfdeyf
    segcapgsppnsrlcqlcqgsggippekcvasshekyfgytgalrclvekgdvafiqhst
    veentggknkadwaknlqmddfellctdgrranvmdyrecnlaevpthavvvrpekanki
    rdllerqekrfgvngsekskfmmfesqnkdllfkdltkclfkvregttykeflgdkfytv
    isslktcnpsdilqmcsflegk