PDB entry 1ovs

View 1ovs on RCSB PDB site
Description: LecB (PA-LII) in complex with core trimannoside
Class: sugar binding protein
Keywords: lectin, carbohydrate
Deposited on 2003-03-27, released 2003-09-09
The last revision prior to the SCOP 1.73 freeze date was dated 2003-09-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.201
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein LecB
    Species: Pseudomonas aeruginosa
    Gene: LecB
    Database cross-references and differences (RAF-indexed):
    • GB AAG06749 (0-113)
    Domains in SCOP 1.73: d1ovsa_
  • Chain 'B':
    Compound: hypothetical protein LecB
    Species: Pseudomonas aeruginosa
    Gene: LecB
    Database cross-references and differences (RAF-indexed):
    • GB AAG06749 (0-113)
    Domains in SCOP 1.73: d1ovsb_
  • Chain 'C':
    Compound: hypothetical protein LecB
    Species: Pseudomonas aeruginosa
    Gene: LecB
    Database cross-references and differences (RAF-indexed):
    • GB AAG06749 (0-113)
    Domains in SCOP 1.73: d1ovsc_
  • Chain 'D':
    Compound: hypothetical protein LecB
    Species: Pseudomonas aeruginosa
    Gene: LecB
    Database cross-references and differences (RAF-indexed):
    • GB AAG06749 (0-113)
    Domains in SCOP 1.73: d1ovsd_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ovsA (A:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ovsB (B:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ovsC (C:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ovsD (D:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg