PDB entry 1ovr

View 1ovr on RCSB PDB site
Description: crystal structure of four-helix bundle model di-mn(ii)-df1-l13
Deposited on 2003-03-27, released 2004-05-18
The last revision prior to the SCOP 1.69 freeze date was dated 2004-05-18, with a file datestamp of 2004-05-18.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: 0.229
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ovra_
  • Chain 'B':
    Domains in SCOP 1.69: d1ovrb_
  • Chain 'C':
    Domains in SCOP 1.69: d1ovrc_
  • Chain 'D':
    Domains in SCOP 1.69: d1ovrd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ovrA (A:)
    dylrellklelqlikqyrealeyvklpvlakiledeekhiewletilg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ovrB (B:)
    dylrellklelqlikqyrealeyvklpvlakiledeekhiewletilg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ovrC (C:)
    dylrellklelqlikqyrealeyvklpvlakiledeekhiewletilg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ovrD (D:)
    dylrellklelqlikqyrealeyvklpvlakiledeekhiewletilg