PDB entry 1ovr

View 1ovr on RCSB PDB site
Description: CRYSTAL STRUCTURE OF FOUR-HELIX BUNDLE MODEL di-Mn(II)-DF1-L13
Class: de novo protein
Keywords: alpha-helical bundle, protein design, de novo protein
Deposited on 2003-03-27, released 2004-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: four-helix bundle model di-Mn(II)-DF1-L13
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1OVR
    Domains in SCOPe 2.08: d1ovra_
  • Chain 'B':
    Compound: four-helix bundle model di-Mn(II)-DF1-L13
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1OVR
    Domains in SCOPe 2.08: d1ovrb_
  • Chain 'C':
    Compound: four-helix bundle model di-Mn(II)-DF1-L13
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1OVR
    Domains in SCOPe 2.08: d1ovrc_
  • Chain 'D':
    Compound: four-helix bundle model di-Mn(II)-DF1-L13
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1OVR
    Domains in SCOPe 2.08: d1ovrd_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ovrA (A:)
    dylrellklelqlikqyrealeyvklpvlakiledeekhiewletilg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ovrB (B:)
    dylrellklelqlikqyrealeyvklpvlakiledeekhiewletilg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ovrC (C:)
    dylrellklelqlikqyrealeyvklpvlakiledeekhiewletilg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ovrD (D:)
    dylrellklelqlikqyrealeyvklpvlakiledeekhiewletilg