PDB entry 1ovp

View 1ovp on RCSB PDB site
Description: LecB (PA-LII) in complex with fructose
Class: sugar binding protein
Keywords: lectin, carbohydrate
Deposited on 2003-03-27, released 2003-09-09
The last revision prior to the SCOP 1.73 freeze date was dated 2003-09-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.182
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein LecB
    Species: Pseudomonas aeruginosa
    Gene: LecB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ovpa_
  • Heterogens: BDF, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ovpA (A:)
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg