PDB entry 1ovo

View 1ovo on RCSB PDB site
Description: crystallographic refinement of japanese quail ovomucoid, a kazal-type inhibitor, and model building studies of complexes with serine proteases
Class: proteinase inhibitor (kazal)
Keywords: proteinase inhibitor (kazal)
Deposited on 1982-01-18, released 1982-05-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ovomucoid third domain
    Species: Coturnix japonica [TaxId:93934]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ovoa_
  • Chain 'B':
    Compound: ovomucoid third domain
    Species: Coturnix japonica [TaxId:93934]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ovob_
  • Chain 'C':
    Compound: ovomucoid third domain
    Species: Coturnix japonica [TaxId:93934]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ovoc_
  • Chain 'D':
    Compound: ovomucoid third domain
    Species: Coturnix japonica [TaxId:93934]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ovod_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ovoA (A:)
    laavsvdcseypkpacpkdyrpvcgsdnktysnkcnfcnavvesngtltlnhfgkc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ovoB (B:)
    laavsvdcseypkpacpkdyrpvcgsdnktysnkcnfcnavvesngtltlnhfgkc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ovoC (C:)
    laavsvdcseypkpacpkdyrpvcgsdnktysnkcnfcnavvesngtltlnhfgkc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ovoD (D:)
    laavsvdcseypkpacpkdyrpvcgsdnktysnkcnfcnavvesngtltlnhfgkc