PDB entry 1ovo
View 1ovo on RCSB PDB site
Description: crystallographic refinement of japanese quail ovomucoid, a kazal-type inhibitor, and model building studies of complexes with serine proteases
Class: proteinase inhibitor (kazal)
Keywords: proteinase inhibitor (kazal)
Deposited on
1982-01-18, released
1982-05-26
The last revision prior to the SCOPe 2.05 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.41
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ovomucoid third domain
Species: Coturnix japonica [TaxId:93934]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1ovoa_ - Chain 'B':
Compound: ovomucoid third domain
Species: Coturnix japonica [TaxId:93934]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1ovob_ - Chain 'C':
Compound: ovomucoid third domain
Species: Coturnix japonica [TaxId:93934]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1ovoc_ - Chain 'D':
Compound: ovomucoid third domain
Species: Coturnix japonica [TaxId:93934]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1ovod_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1ovoA (A:)
laavsvdcseypkpacpkdyrpvcgsdnktysnkcnfcnavvesngtltlnhfgkc
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1ovoB (B:)
laavsvdcseypkpacpkdyrpvcgsdnktysnkcnfcnavvesngtltlnhfgkc
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1ovoC (C:)
laavsvdcseypkpacpkdyrpvcgsdnktysnkcnfcnavvesngtltlnhfgkc
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1ovoD (D:)
laavsvdcseypkpacpkdyrpvcgsdnktysnkcnfcnavvesngtltlnhfgkc