PDB entry 1ovn

View 1ovn on RCSB PDB site
Description: Crystal Structure and Functional Analysis of Drosophila Wind-- a PDI-Related Protein
Class: chaperone
Keywords: Wind, Windbeutel, PDI-Dbeta, PDI, protein disulfide isomerase, Pipe, dorsal-ventral patterning, chaperone
Deposited on 2003-03-27, released 2004-02-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Windbeutel
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Wind
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ovna1, d1ovna2
  • Chain 'B':
    Compound: Windbeutel
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Wind
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ovnb1, d1ovnb2
  • Heterogens: CS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ovnA (A:)
    mrgshhhhhhgsvtctgcvdldelsfektverfpysvvkfdiaypygekheaftafsksa
    hkatkdlliatvgvkdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtl
    dnlkafvsantplyigrdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqq
    narayliymrkihevgydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvtk
    tapekeel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ovnA (A:)
    ctgcvdldelsfektverfpysvvkfdiaypygekheaftafsksahkatkdlliatvgv
    kdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtldnlkafvsantply
    igrdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkihe
    vgydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvtktap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ovnB (B:)
    mrgshhhhhhgsvtctgcvdldelsfektverfpysvvkfdiaypygekheaftafsksa
    hkatkdlliatvgvkdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtl
    dnlkafvsantplyigrdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqq
    narayliymrkihevgydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvtk
    tapekeel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ovnB (B:)
    tctgcvdldelsfektverfpysvvkfdiaypygekheaftafsksahkatkdlliatvg
    vkdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtldnlkafvsantpl
    yigrdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkih
    evgydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvt