PDB entry 1ovm

View 1ovm on RCSB PDB site
Description: Crystal structure of Indolepyruvate decarboxylase from Enterobacter cloacae
Deposited on 2003-03-27, released 2003-06-03
The last revision prior to the SCOP 1.65 freeze date was dated 2003-06-03, with a file datestamp of 2003-06-03.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.205
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ovmA (A:)
    mrtpycvadylldrltdcgadhlfgvpgdynlqfldhvidspdicwvgcanelnasyaad
    gyarckgfaallttfgvgelsamngiagsyaehvpvlhivgapgtaaqqrgellhhtlgd
    gefrhfyhmsepitvaqavlteqnacyeidrvlttmlrerrpgylmlpadvakkaatppv
    nalthkqahadsaclkafrdaaenklamskrtalladflvlrhglkhalqkwvkevpmah
    atmlmgkgifderqagfygtysgsastgavkeaiegadtvlcvgtrftdtltagfthqlt
    paqtievqphaarvgdvwftgipmnqaietlvelckqhvhaglmssssgaipfpqpdgsl
    tqenfwrtlqtfirpgdiiladqgtsafgaidlrlpadvnfivqplwgsigytlaaafga
    qtacpnrrvivltgdgaaqltiqelgsmlrdkqhpiilvlnnegytveraihgaeqrynd
    ialwnwthipqalsldpqsecwrvseaeqladvlekvahherlslievmlpkadippllg
    altkaleacnna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ovmA (A:)
    tpycvadylldrltdcgadhlfgvpgdynlqfldhvidspdicwvgcanelnasyaadgy
    arckgfaallttfgvgelsamngiagsyaehvpvlhivgapgtaaqqrgellhhtlgdge
    frhfyhmsepitvaqavlteqnacyeidrvlttmlrerrpgylmlpadvakkaatppvna
    lthkqahadsaclkafrdaaenklamskrtalladflvlrhglkhalqkwvkevpmahat
    mlmgkgifderqagfygtysgsastgavkeaiegadtvlcvgtrftdtltagfthqltpa
    qtievqphaarvgdvwftgipmnqaietlvelckqhvhapdgsltqenfwrtlqtfirpg
    diiladqgtsafgaidlrlpadvnfivqplwgsigytlaaafgaqtacpnrrvivltgdg
    aaqltiqelgsmlrdkqhpiilvlnnegytveraihgaeqryndialwnwthipqalsld
    pqsecwrvseaeqladvlekvahherlslievmlpkadippllgaltkaleacnn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ovmB (B:)
    mrtpycvadylldrltdcgadhlfgvpgdynlqfldhvidspdicwvgcanelnasyaad
    gyarckgfaallttfgvgelsamngiagsyaehvpvlhivgapgtaaqqrgellhhtlgd
    gefrhfyhmsepitvaqavlteqnacyeidrvlttmlrerrpgylmlpadvakkaatppv
    nalthkqahadsaclkafrdaaenklamskrtalladflvlrhglkhalqkwvkevpmah
    atmlmgkgifderqagfygtysgsastgavkeaiegadtvlcvgtrftdtltagfthqlt
    paqtievqphaarvgdvwftgipmnqaietlvelckqhvhaglmssssgaipfpqpdgsl
    tqenfwrtlqtfirpgdiiladqgtsafgaidlrlpadvnfivqplwgsigytlaaafga
    qtacpnrrvivltgdgaaqltiqelgsmlrdkqhpiilvlnnegytveraihgaeqrynd
    ialwnwthipqalsldpqsecwrvseaeqladvlekvahherlslievmlpkadippllg
    altkaleacnna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ovmB (B:)
    tpycvadylldrltdcgadhlfgvpgdynlqfldhvidspdicwvgcanelnasyaadgy
    arckgfaallttfgvgelsamngiagsyaehvpvlhivgapgtaaqqrgellhhtlgdge
    frhfyhmsepitvaqavlteqnacyeidrvlttmlrerrpgylmlpadvakkaatppvna
    lthkqahadsaclkafrdaaenklamskrtalladflvlrhglkhalqkwvkevpmahat
    mlmgkgifderqagfygtysgsastgavkeaiegadtvlcvgtrftdtltagfthqltpa
    qtievqphaarvgdvwftgipmnqaietlvelckqhvhapdgsltqenfwrtlqtfirpg
    diiladqgtsafgaidlrlpadvnfivqplwgsigytlaaafgaqtacpnrrvivltgdg
    aaqltiqelgsmlrdkqhpiilvlnnegytveraihgaeqryndialwnwthipqalsld
    pqsecwrvseaeqladvlekvahherlslievmlpkadippllgaltkaleacnn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ovmC (C:)
    mrtpycvadylldrltdcgadhlfgvpgdynlqfldhvidspdicwvgcanelnasyaad
    gyarckgfaallttfgvgelsamngiagsyaehvpvlhivgapgtaaqqrgellhhtlgd
    gefrhfyhmsepitvaqavlteqnacyeidrvlttmlrerrpgylmlpadvakkaatppv
    nalthkqahadsaclkafrdaaenklamskrtalladflvlrhglkhalqkwvkevpmah
    atmlmgkgifderqagfygtysgsastgavkeaiegadtvlcvgtrftdtltagfthqlt
    paqtievqphaarvgdvwftgipmnqaietlvelckqhvhaglmssssgaipfpqpdgsl
    tqenfwrtlqtfirpgdiiladqgtsafgaidlrlpadvnfivqplwgsigytlaaafga
    qtacpnrrvivltgdgaaqltiqelgsmlrdkqhpiilvlnnegytveraihgaeqrynd
    ialwnwthipqalsldpqsecwrvseaeqladvlekvahherlslievmlpkadippllg
    altkaleacnna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ovmC (C:)
    tpycvadylldrltdcgadhlfgvpgdynlqfldhvidspdicwvgcanelnasyaadgy
    arckgfaallttfgvgelsamngiagsyaehvpvlhivgapgtaaqqrgellhhtlgdge
    frhfyhmsepitvaqavlteqnacyeidrvlttmlrerrpgylmlpadvakkaatppvna
    lthkqahadsaclkafrdaaenklamskrtalladflvlrhglkhalqkwvkevpmahat
    mlmgkgifderqagfygtysgsastgavkeaiegadtvlcvgtrftdtltagfthqltpa
    qtievqphaarvgdvwftgipmnqaietlvelckqhvhapdgsltqenfwrtlqtfirpg
    diiladqgtsafgaidlrlpadvnfivqplwgsigytlaaafgaqtacpnrrvivltgdg
    aaqltiqelgsmlrdkqhpiilvlnnegytveraihgaeqryndialwnwthipqalsld
    pqsecwrvseaeqladvlekvahherlslievmlpkadippllgaltkaleacnn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ovmD (D:)
    mrtpycvadylldrltdcgadhlfgvpgdynlqfldhvidspdicwvgcanelnasyaad
    gyarckgfaallttfgvgelsamngiagsyaehvpvlhivgapgtaaqqrgellhhtlgd
    gefrhfyhmsepitvaqavlteqnacyeidrvlttmlrerrpgylmlpadvakkaatppv
    nalthkqahadsaclkafrdaaenklamskrtalladflvlrhglkhalqkwvkevpmah
    atmlmgkgifderqagfygtysgsastgavkeaiegadtvlcvgtrftdtltagfthqlt
    paqtievqphaarvgdvwftgipmnqaietlvelckqhvhaglmssssgaipfpqpdgsl
    tqenfwrtlqtfirpgdiiladqgtsafgaidlrlpadvnfivqplwgsigytlaaafga
    qtacpnrrvivltgdgaaqltiqelgsmlrdkqhpiilvlnnegytveraihgaeqrynd
    ialwnwthipqalsldpqsecwrvseaeqladvlekvahherlslievmlpkadippllg
    altkaleacnna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ovmD (D:)
    tpycvadylldrltdcgadhlfgvpgdynlqfldhvidspdicwvgcanelnasyaadgy
    arckgfaallttfgvgelsamngiagsyaehvpvlhivgapgtaaqqrgellhhtlgdge
    frhfyhmsepitvaqavlteqnacyeidrvlttmlrerrpgylmlpadvakkaatppvna
    lthkqahadsaclkafrdaaenklamskrtalladflvlrhglkhalqkwvkevpmahat
    mlmgkgifderqagfygtysgsastgavkeaiegadtvlcvgtrftdtltagfthqltpa
    qtievqphaarvgdvwftgipmnqaietlvelckqhvhapdgsltqenfwrtlqtfirpg
    diiladqgtsafgaidlrlpadvnfivqplwgsigytlaaafgaqtacpnrrvivltgdg
    aaqltiqelgsmlrdkqhpiilvlnnegytveraihgaeqryndialwnwthipqalsld
    pqsecwrvseaeqladvlekvahherlslievmlpkadippllgaltkaleacnn