PDB entry 1ovl

View 1ovl on RCSB PDB site
Description: Crystal Structure of Nurr1 LBD
Deposited on 2003-03-26, released 2003-06-03
The last revision prior to the SCOP 1.65 freeze date was dated 2003-06-03, with a file datestamp of 2003-06-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1ovla_
  • Chain 'B':
    Domains in SCOP 1.65: d1ovlb_
  • Chain 'C':
    Domains in SCOP 1.65: d1ovlc_
  • Chain 'D':
    Domains in SCOP 1.65: d1ovld_
  • Chain 'E':
    Domains in SCOP 1.65: d1ovle_
  • Chain 'F':
    Domains in SCOP 1.65: d1ovlf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ovlA (A:)
    mvkevvrtdslkgrrgrlpskpkspqepsppsppvslisalvrahvdsnpamtsldysrf
    qanpdyqmsgddtqhiqqfydlltgsmeiirgwaekipgfadlpkadqdllfesaflelf
    vlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsivefssnlqnmnidisafscia
    alamvterhglkepkrveelqnkivnclkdhvtfnngglnrpnylskllgklpelrtlct
    qglqrifylkledlvpppaiidklfldtlpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ovlA (A:)
    slisalvrahvdsnpamtsldysrfqandtqhiqqfydlltgsmeiirgwaekipgfadl
    pkadqdllfesaflelfvlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsivefs
    snlqnmnidisafsciaalamvterhglkepkrveelqnkivnclkdhvtfnngglnrpn
    ylskllgklpelrtlctqglqrifylkledlvpppaiidklfldtlpf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ovlB (B:)
    mvkevvrtdslkgrrgrlpskpkspqepsppsppvslisalvrahvdsnpamtsldysrf
    qanpdyqmsgddtqhiqqfydlltgsmeiirgwaekipgfadlpkadqdllfesaflelf
    vlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsivefssnlqnmnidisafscia
    alamvterhglkepkrveelqnkivnclkdhvtfnngglnrpnylskllgklpelrtlct
    qglqrifylkledlvpppaiidklfldtlpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ovlB (B:)
    slisalvrahvdsnpamtsldysrfqanpdyqmsgddtqhiqqfydlltgsmeiirgwae
    kipgfadlpkadqdllfesaflelfvlrlayrsnpvegklifcngvvlhrlqcvrgfgew
    idsivefssnlqnmnidisafsciaalamvterhglkepkrveelqnkivnclkdhvtfn
    ngglnrpnylskllgklpelrtlctqglqrifylkledlvpppaiidklfldtlpf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ovlC (C:)
    mvkevvrtdslkgrrgrlpskpkspqepsppsppvslisalvrahvdsnpamtsldysrf
    qanpdyqmsgddtqhiqqfydlltgsmeiirgwaekipgfadlpkadqdllfesaflelf
    vlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsivefssnlqnmnidisafscia
    alamvterhglkepkrveelqnkivnclkdhvtfnngglnrpnylskllgklpelrtlct
    qglqrifylkledlvpppaiidklfldtlpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ovlC (C:)
    slisalvrahvdsnpamtsldysrfqanpgddtqhiqqfydlltgsmeiirgwaekipgf
    adlpkadqdllfesaflelfvlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsiv
    efssnlqnmnidisafsciaalamvterhglkepkrveelqnkivnclkdhvtfnnpnyl
    skllgklpelrtlctqglqrifylkledlvpppaiidklfldtlpf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ovlD (D:)
    mvkevvrtdslkgrrgrlpskpkspqepsppsppvslisalvrahvdsnpamtsldysrf
    qanpdyqmsgddtqhiqqfydlltgsmeiirgwaekipgfadlpkadqdllfesaflelf
    vlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsivefssnlqnmnidisafscia
    alamvterhglkepkrveelqnkivnclkdhvtfnngglnrpnylskllgklpelrtlct
    qglqrifylkledlvpppaiidklfldtlpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ovlD (D:)
    slisalvrahvdsnpamtsldysrfqanpddtqhiqqfydlltgsmeiirgwaekipgfa
    dlpkadqdllfesaflelfvlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsive
    fssnlqnmnidisafsciaalamvterhglkepkrveelqnkivnclkdhvtfnngglnr
    pnylskllgklpelrtlctqglqrifylkledlvpppaiidklfldtlpf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ovlE (E:)
    mvkevvrtdslkgrrgrlpskpkspqepsppsppvslisalvrahvdsnpamtsldysrf
    qanpdyqmsgddtqhiqqfydlltgsmeiirgwaekipgfadlpkadqdllfesaflelf
    vlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsivefssnlqnmnidisafscia
    alamvterhglkepkrveelqnkivnclkdhvtfnngglnrpnylskllgklpelrtlct
    qglqrifylkledlvpppaiidklfldtlpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ovlE (E:)
    rtdslkgrrgrlpsslisalvrahvdsnpamtsldysrfqanpdyqmsgddtqhiqqfyd
    lltgsmeiirgwaekipgfadlpkadqdllfesaflelfvlrlayrsnpvegklifcngv
    vlhrlqcvrgfgewidsivefssnlqnmnidisafsciaalamvterhglkepkrveelq
    nkivnclkdhvtfnngglnrpnylskllgklpelrtlctqglqrifylkledlvpppaii
    dklfldtlpf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ovlF (F:)
    mvkevvrtdslkgrrgrlpskpkspqepsppsppvslisalvrahvdsnpamtsldysrf
    qanpdyqmsgddtqhiqqfydlltgsmeiirgwaekipgfadlpkadqdllfesaflelf
    vlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsivefssnlqnmnidisafscia
    alamvterhglkepkrveelqnkivnclkdhvtfnngglnrpnylskllgklpelrtlct
    qglqrifylkledlvpppaiidklfldtlpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ovlF (F:)
    slisalvrahvdsnpamtsldysrfqandtqhiqqfydlltgsmeiirgwaekipgfadl
    pkadqdllfesaflelfvlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsivefs
    snlqnmnidisafsciaalamvterhglkepkrveelqnkivnclkdhvtfnnpnylskl
    lgklpelrtlctqglqrifylkledlvpppaiidklfldtlpf