PDB entry 1ovd

View 1ovd on RCSB PDB site
Description: the k136e mutant of lactococcus lactis dihydroorotate dehydrogenase a in complex with orotate
Class: oxidoreductase
Keywords: homodimer, alpha-beta barrel, flavoprotein, orotate complex, mutant enzyme, oxidoreductase
Deposited on 2003-03-26, released 2003-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.178
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroorotate dehydrogenase a
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: PYRDA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54321 (0-310)
      • engineered (135)
    Domains in SCOPe 2.07: d1ovda_
  • Chain 'B':
    Compound: dihydroorotate dehydrogenase a
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: PYRDA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54321 (0-310)
      • engineered (135)
    Domains in SCOPe 2.07: d1ovdb_
  • Heterogens: MG, FMN, ORO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ovdA (A:)
    mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd
    lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
    sgitelnlscpnvpgepqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
    lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk
    peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
    iadfhgklksl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ovdB (B:)
    mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd
    lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
    sgitelnlscpnvpgepqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
    lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk
    peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
    iadfhgklksl