PDB entry 1ovb

View 1ovb on RCSB PDB site
Description: the mechanism of iron uptake by transferrins: the structure of an 18kd nii-domain fragment at 2.3 angstroms resolution
Class: iron transport protein
Keywords: iron transport protein
Deposited on 1992-10-05, released 1994-01-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.195
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ovotransferrin
  Species: Anas sp. [TaxId:42806]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56410 (0-158)
    • conflict (56-57)
    • conflict (95)
  Domains in SCOPe 2.04: d1ovba_
• Heterogens: FE, CO3, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ovbA (A:)
  syyavavvkkgtdfmikdlrgktschtglgrsagwnipigtlihrediewegiesgsveq
  avakffsascvpgatieqklcrqckgdaktkclrnapysgysgafqclkdgkgdvafvkh
  ttvqenapeekdeyellcldgsrqpvdsyktcnwarvaa