PDB entry 1ovb

View 1ovb on RCSB PDB site
Description: the mechanism of iron uptake by transferrins: the structure of an 18kd nii-domain fragment at 2.3 angstroms resolution
Deposited on 1992-10-05, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.195
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1ovb__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ovb_ (-)
  syyavavvkkgtdfmikdlrgktschtglgrsagwnipigtlihrediewegiesgsveq
  avakffsascvpgatieqklcrqckgdaktkclrnapysgysgafqclkdgkgdvafvkh
  ttvqenapeekdeyellcldgsrqpvdsyktcnwarvaa