PDB entry 1ov2

View 1ov2 on RCSB PDB site
Description: Ensemble of the solution structures of domain one of receptor associated protein
Class: Receptor Associated Protein
Keywords: Helical protein, Receptor Associated Protein
Deposited on 2003-03-25, released 2004-04-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-2-macroglobulin receptor-associated protein precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: LRPAP1 OR A2MRAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ov2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ov2A (A:)
    ysreknqpkpspkresgeefrmeklnqlwekaqrlhlppvrlaelhadlkiqerdelawk
    klkldgldedgekearlirnlnvilakygldgkkdarqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ov2A (A:)
    geefrmeklnqlwekaqrlhlppvrlaelhadlkiqerdelawkklkldgldedgekear
    lirnlnvilakygldgkkdarq