PDB entry 1oux

View 1oux on RCSB PDB site
Description: LecB (PA-LII) sugar-free
Class: sugar binding protein
Keywords: lectin, carbohydrate
Deposited on 2003-03-25, released 2003-09-09
The last revision prior to the SCOP 1.73 freeze date was dated 2003-09-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein LecB
    Species: Pseudomonas aeruginosa
    Gene: LecB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ouxa_
  • Chain 'B':
    Compound: hypothetical protein LecB
    Species: Pseudomonas aeruginosa
    Gene: LecB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ouxb_
  • Chain 'C':
    Compound: hypothetical protein LecB
    Species: Pseudomonas aeruginosa
    Gene: LecB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ouxc_
  • Chain 'D':
    Compound: hypothetical protein LecB
    Species: Pseudomonas aeruginosa
    Gene: LecB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ouxd_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ouxA (A:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ouxB (B:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ouxC (C:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ouxD (D:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg