PDB entry 1ouw

View 1ouw on RCSB PDB site
Description: Crystal structure of Calystegia sepium agglutinin
Class: sugar binding protein
Keywords: beta-prism fold, agglutinin, lectin, mannose-binding, jacalin-related, sugar binding protein
Deposited on 2003-03-25, released 2003-11-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: 0.153
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Calystegia sepium [TaxId:47519]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P93114 (0-End)
      • modified residue (0)
    Domains in SCOPe 2.08: d1ouwa_
  • Chain 'B':
    Compound: lectin
    Species: Calystegia sepium [TaxId:47519]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P93114 (0-151)
      • modified residue (0)
    Domains in SCOPe 2.08: d1ouwb_
  • Chain 'C':
    Compound: lectin
    Species: Calystegia sepium [TaxId:47519]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P93114 (0-151)
      • modified residue (0)
    Domains in SCOPe 2.08: d1ouwc_
  • Chain 'D':
    Compound: lectin
    Species: Calystegia sepium [TaxId:47519]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P93114 (0-151)
      • modified residue (0)
    Domains in SCOPe 2.08: d1ouwd_
  • Heterogens: MLT, EDO, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ouwA (A:)
    avpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitv
    ggggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtp
    fssanvvgneivgflgrsgyyvdaigtynrhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ouwA (A:)
    avpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitv
    ggggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtp
    fssanvneivgflgrsgyyvdaigtynrh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ouwB (B:)
    avpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitv
    ggggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtp
    fssanvvgneivgflgrsgyyvdaigtynrhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ouwB (B:)
    avpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkgskdtitvgg
    ggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtpfs
    sanvvgneivgflgrsgyyvdaigtynrhk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ouwC (C:)
    avpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitv
    ggggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtp
    fssanvvgneivgflgrsgyyvdaigtynrhk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ouwD (D:)
    avpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitv
    ggggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtp
    fssanvvgneivgflgrsgyyvdaigtynrhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ouwD (D:)
    avpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitv
    ggggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtp
    fssavvgneivgflgrsgyyvdaigtynrhk