PDB entry 1ouv

View 1ouv on RCSB PDB site
Description: Helicobacter cysteine rich protein C (HcpC)
Class: hydrolase
Keywords: tpr repeat, hcp repeat, cysteine rich protein, loop-helix-turn-helix, repeat protein, hydrolase
Deposited on 2003-03-25, released 2004-03-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Conserved hypothetical secreted protein
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: HP1098
    Database cross-references and differences (RAF-indexed):
    • Uniprot O25728 (Start-266)
      • expression tag (267-268)
    Domains in SCOPe 2.06: d1ouva1, d1ouva2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ouvA (A:)
    maeqdpkelvglgaksykekdftqakkyfekacdlkensgcfnlgvlyyqgqgveknlkk
    aasfyakacdlnysngchllgnlyysgqgvsqntnkalqyyskacdlkyaegcaslggiy
    hdgkvvtrdfkkaveyftkacdlndgdgctilgslydagrgtpkdlkkalasydkacdlk
    dspgcfnagnmyhhgegatknfkealaryskacelengggcfnlgamqyngegvtrnekq
    aienfkkgcklgakgacdilkqlkikvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ouvA (A:)
    dpkelvglgaksykekdftqakkyfekacdlkensgcfnlgvlyyqgqgveknlkkaasf
    yakacdlnysngchllgnlyysgqgvsqntnkalqyyskacdlkyaegcaslggiyhdgk
    vvtrdfkkaveyftkacdlndgdgctilgslydagrgtpkdlkkalasydkacdlkdspg
    cfnagnmyhhgegatknfkealaryskacelengggcfnlgamqyngegvtrnekqaien
    fkkgcklgakgacdilkqlkikvhh