PDB entry 1ouv

View 1ouv on RCSB PDB site
Description: Helicobacter cysteine rich protein C (HcpC)
Deposited on 2003-03-25, released 2004-03-30
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-30, with a file datestamp of 2004-03-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ouva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ouvA (A:)
    maeqdpkelvglgaksykekdftqakkyfekacdlkensgcfnlgvlyyqgqgveknlkk
    aasfyakacdlnysngchllgnlyysgqgvsqntnkalqyyskacdlkyaegcaslggiy
    hdgkvvtrdfkkaveyftkacdlndgdgctilgslydagrgtpkdlkkalasydkacdlk
    dspgcfnagnmyhhgegatknfkealaryskacelengggcfnlgamqyngegvtrnekq
    aienfkkgcklgakgacdilkqlkikvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ouvA (A:)
    dpkelvglgaksykekdftqakkyfekacdlkensgcfnlgvlyyqgqgveknlkkaasf
    yakacdlnysngchllgnlyysgqgvsqntnkalqyyskacdlkyaegcaslggiyhdgk
    vvtrdfkkaveyftkacdlndgdgctilgslydagrgtpkdlkkalasydkacdlkdspg
    cfnagnmyhhgegatknfkealaryskacelengggcfnlgamqyngegvtrnekqaien
    fkkgcklgakgacdilkqlkikvhh