PDB entry 1our

View 1our on RCSB PDB site
Description: lecb (pa-lii) in complex with mannose
Deposited on 2003-03-25, released 2003-09-09
The last revision prior to the SCOP 1.71 freeze date was dated 2003-09-09, with a file datestamp of 2003-09-09.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: 0.182
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1oura_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ourA (A:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg