PDB entry 1oul

View 1oul on RCSB PDB site
Description: Structure of the AAA+ protease delivery protein SspB
Class: transport protein
Keywords: ssrA peptide binding protein, homodimer, TRANSPORT PROTEIN
Deposited on 2003-03-24, released 2003-09-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.256
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stringent starvation protein B homolog
    Species: Haemophilus influenzae [TaxId:727]
    Gene: SSPB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45206 (0-End)
      • modified residue (0)
      • modified residue (85)
      • modified residue (101)
    Domains in SCOPe 2.08: d1oula_
  • Chain 'B':
    Compound: Stringent starvation protein B homolog
    Species: Haemophilus influenzae [TaxId:727]
    Gene: SSPB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45206
      • modified residue (85)
      • modified residue (101)
    Domains in SCOPe 2.08: d1oulb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oulA (A:)
    meyksspkrpyllrayydwlvdnsftpylvvdatylgvnvpveyvkdgqivlnlsasatg
    nlqltndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiydelniepdteq
    ptgfyeavd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oulA (A:)
    meyksspkrpyllrayydwlvdnsftpylvvdatylgvnvpveyvkdgqivlnlsasatg
    nlqltndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiydelniepdteq
    pt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oulB (B:)
    meyksspkrpyllrayydwlvdnsftpylvvdatylgvnvpveyvkdgqivlnlsasatg
    nlqltndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiydelniepdteq
    ptgfyeavd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oulB (B:)
    spkrpyllrayydwlvdnsftpylvvdatylgvnvpveyvkdgqivlnlsasatgnlqlt
    ndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiydelniepdteqptgfy
    e