PDB entry 1oug

View 1oug on RCSB PDB site
Description: contribution of hydrophobic residues to the stability of human lysozyme: x-ray structure of the v2a mutant
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl), signal, amyloid, disease mutation
Deposited on 1996-08-23, released 1997-02-12
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.173
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: HOMO SAPIENS
    Gene: HUMAN LYSOZYME WITH VAL 2 REPL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (1)
    Domains in SCOP 1.75: d1ouga_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ougA (A:)
    kafercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv