PDB entry 1ouc

View 1ouc on RCSB PDB site
Description: contribution of hydrophobic residues to the stability of human lysozyme: x-ray structure of the v110a mutant
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl), signal, amyloid, disease mutation
Deposited on 1996-08-23, released 1997-02-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.153
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN LYSOZYME WITH VAL 110
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (109)
    Domains in SCOPe 2.06: d1ouca_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oucA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawaawrnrcqnrd
    vrqyvqgcgv