PDB entry 1oua

View 1oua on RCSB PDB site
Description: contribution of hydrophobic residues to the stability of human lysozyme: x-ray structure of the i56t mutant
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl), signal, amyloid, disease mutation
Deposited on 1996-08-23, released 1997-02-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.148
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN LYSOZYME WITH ILE 56 REP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ouaa_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ouaA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygtfqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv