PDB entry 1ou0

View 1ou0 on RCSB PDB site
Description: precorrin-8x methylmutase related protein
Deposited on 2003-03-24, released 2003-10-07
The last revision prior to the SCOP 1.67 freeze date was dated 2003-10-07, with a file datestamp of 2003-10-07.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.202
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ou0a_
  • Chain 'B':
    Domains in SCOP 1.67: d1ou0b_
  • Chain 'C':
    Domains in SCOP 1.67: d1ou0c_
  • Chain 'D':
    Domains in SCOP 1.67: d1ou0d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ou0A (A:)
    maaageeyssdkieerslaaidsmidpdisgpmrhivvkaihaagdfaiaplirysdgff
    ksmlaklkegctiicdsemvragiysrpvlernrvvcylndvrskemadvngitrsaagi
    riamqdhrnsvivignaptalleamrmieengwydipivgipvgfinaskakeglvsshi
    eyisveghrggspiaasivngfgrfla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ou0A (A:)
    slaaidsmidpdisgpmrhivvkaihaagdfaiaplirysdgffksmlaklkegctiicd
    semvragiysrpvlernrvvcylndvrskemadvngitrsaagiriamqdhrnsvivign
    aptalleamrmieengwydipivgipvgfinaskakeglvsshieyisveghrggspiaa
    sivngfgrfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ou0B (B:)
    maaageeyssdkieerslaaidsmidpdisgpmrhivvkaihaagdfaiaplirysdgff
    ksmlaklkegctiicdsemvragiysrpvlernrvvcylndvrskemadvngitrsaagi
    riamqdhrnsvivignaptalleamrmieengwydipivgipvgfinaskakeglvsshi
    eyisveghrggspiaasivngfgrfla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ou0B (B:)
    eerslaaidsmidpdisgpmrhivvkaihaagdfaiaplirysdgffksmlaklkegcti
    icdsemvragiysrpvlernrvvcylndvrskemadvngitrsaagiriamqdhrnsviv
    ignaptalleamrmieengwydipivgipvgfinaskakeglvsshieyisveghrggsp
    iaasivngfgrfl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ou0C (C:)
    maaageeyssdkieerslaaidsmidpdisgpmrhivvkaihaagdfaiaplirysdgff
    ksmlaklkegctiicdsemvragiysrpvlernrvvcylndvrskemadvngitrsaagi
    riamqdhrnsvivignaptalleamrmieengwydipivgipvgfinaskakeglvsshi
    eyisveghrggspiaasivngfgrfla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ou0C (C:)
    rslaaidsmidpdisgpmrhivvkaihaagdfaiaplirysdgffksmlaklkegctiic
    dsemvragiysrpvlernrvvcylndvrskemadvngitrsaagiriamqdhrnsvivig
    naptalleamrmieengwydipivgipvgfinaskakeglvsshieyisveghrggspia
    asivngfgrfl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ou0D (D:)
    maaageeyssdkieerslaaidsmidpdisgpmrhivvkaihaagdfaiaplirysdgff
    ksmlaklkegctiicdsemvragiysrpvlernrvvcylndvrskemadvngitrsaagi
    riamqdhrnsvivignaptalleamrmieengwydipivgipvgfinaskakeglvsshi
    eyisveghrggspiaasivngfgrfla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ou0D (D:)
    rslaaidsmidpdisgpmrhivvkaihaagdfaiaplirysdgffksmlaklkegctiic
    dsemvragiysrpvlernrvvcylndvrskemadvngitrsaagiriamqdhrnsvivig
    naptalleamrmieengwydipivgipvgfinaskakeglvsshieyisveghrggspia
    asivngfgrfl