PDB entry 1ou0

View 1ou0 on RCSB PDB site
Description: precorrin-8X methylmutase related protein
Class: isomerase
Keywords: structural genomics, methylmutase, precorrin-8X, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, ISOMERASE
Deposited on 2003-03-24, released 2003-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: precorrin-8X methylmutase related protein
    Species: Thermoplasma acidophilum [TaxId:273075]
    Gene: Ta0654
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HKE7
      • modified residue (23)
      • modified residue (32)
      • modified residue (62)
      • modified residue (78)
      • modified residue (106)
      • modified residue (123)
      • modified residue (144)
      • modified residue (146)
    Domains in SCOPe 2.08: d1ou0a_
  • Chain 'B':
    Compound: precorrin-8X methylmutase related protein
    Species: Thermoplasma acidophilum [TaxId:273075]
    Gene: Ta0654
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HKE7
      • modified residue (23)
      • modified residue (32)
      • modified residue (62)
      • modified residue (78)
      • modified residue (106)
      • modified residue (123)
      • modified residue (144)
      • modified residue (146)
    Domains in SCOPe 2.08: d1ou0b_
  • Chain 'C':
    Compound: precorrin-8X methylmutase related protein
    Species: Thermoplasma acidophilum [TaxId:273075]
    Gene: Ta0654
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HKE7
      • modified residue (23)
      • modified residue (32)
      • modified residue (62)
      • modified residue (78)
      • modified residue (106)
      • modified residue (123)
      • modified residue (144)
      • modified residue (146)
    Domains in SCOPe 2.08: d1ou0c_
  • Chain 'D':
    Compound: precorrin-8X methylmutase related protein
    Species: Thermoplasma acidophilum [TaxId:273075]
    Gene: Ta0654
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HKE7
      • modified residue (23)
      • modified residue (32)
      • modified residue (62)
      • modified residue (78)
      • modified residue (106)
      • modified residue (123)
      • modified residue (144)
      • modified residue (146)
    Domains in SCOPe 2.08: d1ou0d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ou0A (A:)
    maaageeyssdkieerslaaidsmidpdisgpmrhivvkaihaagdfaiaplirysdgff
    ksmlaklkegctiicdsemvragiysrpvlernrvvcylndvrskemadvngitrsaagi
    riamqdhrnsvivignaptalleamrmieengwydipivgipvgfinaskakeglvsshi
    eyisveghrggspiaasivngfgrfla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ou0A (A:)
    slaaidsmidpdisgpmrhivvkaihaagdfaiaplirysdgffksmlaklkegctiicd
    semvragiysrpvlernrvvcylndvrskemadvngitrsaagiriamqdhrnsvivign
    aptalleamrmieengwydipivgipvgfinaskakeglvsshieyisveghrggspiaa
    sivngfgrfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ou0B (B:)
    maaageeyssdkieerslaaidsmidpdisgpmrhivvkaihaagdfaiaplirysdgff
    ksmlaklkegctiicdsemvragiysrpvlernrvvcylndvrskemadvngitrsaagi
    riamqdhrnsvivignaptalleamrmieengwydipivgipvgfinaskakeglvsshi
    eyisveghrggspiaasivngfgrfla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ou0B (B:)
    eerslaaidsmidpdisgpmrhivvkaihaagdfaiaplirysdgffksmlaklkegcti
    icdsemvragiysrpvlernrvvcylndvrskemadvngitrsaagiriamqdhrnsviv
    ignaptalleamrmieengwydipivgipvgfinaskakeglvsshieyisveghrggsp
    iaasivngfgrfl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ou0C (C:)
    maaageeyssdkieerslaaidsmidpdisgpmrhivvkaihaagdfaiaplirysdgff
    ksmlaklkegctiicdsemvragiysrpvlernrvvcylndvrskemadvngitrsaagi
    riamqdhrnsvivignaptalleamrmieengwydipivgipvgfinaskakeglvsshi
    eyisveghrggspiaasivngfgrfla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ou0C (C:)
    rslaaidsmidpdisgpmrhivvkaihaagdfaiaplirysdgffksmlaklkegctiic
    dsemvragiysrpvlernrvvcylndvrskemadvngitrsaagiriamqdhrnsvivig
    naptalleamrmieengwydipivgipvgfinaskakeglvsshieyisveghrggspia
    asivngfgrfl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ou0D (D:)
    maaageeyssdkieerslaaidsmidpdisgpmrhivvkaihaagdfaiaplirysdgff
    ksmlaklkegctiicdsemvragiysrpvlernrvvcylndvrskemadvngitrsaagi
    riamqdhrnsvivignaptalleamrmieengwydipivgipvgfinaskakeglvsshi
    eyisveghrggspiaasivngfgrfla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ou0D (D:)
    rslaaidsmidpdisgpmrhivvkaihaagdfaiaplirysdgffksmlaklkegctiic
    dsemvragiysrpvlernrvvcylndvrskemadvngitrsaagiriamqdhrnsvivig
    naptalleamrmieengwydipivgipvgfinaskakeglvsshieyisveghrggspia
    asivngfgrfl