PDB entry 1otv

View 1otv on RCSB PDB site
Description: PqqC, Pyrroloquinolinquinone Synthase C
Class: biosynthetic protein
Keywords: seven helix bundle, dimer, PQQ biosynthesis enzyme, BIOSYNTHETIC PROTEIN
Deposited on 2003-03-23, released 2004-05-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.197
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coenzyme PQQ synthesis protein C
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: PQQC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27505
      • engineered (20)
      • expression tag (251-254)
    Domains in SCOPe 2.06: d1otva1, d1otva2
  • Chain 'B':
    Compound: Coenzyme PQQ synthesis protein C
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: PQQC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27505
      • engineered (20)
      • expression tag (251-254)
    Domains in SCOPe 2.06: d1otvb1, d1otvb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1otvA (A:)
    mlitdtlspqafeealrakgdfyhihhpyhiamhngdatrkqiqgwvanrfyyqttiplk
    daaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpg
    vrfavdaylnfarracwqeaacssltelfapqihqsrldswpqhypwikeegyfyfrsrl
    sqanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvt
    dkaawhttrlvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1otvA (A:)
    litdtlspqafeealrakgdfyhihhpyhiamhngdatrkqiqgwvanrfyyqttiplkd
    aaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpgv
    rfavdaylnfarracwqeaacssltelfapqihqsrldswpqhypwikeegyfyfrsrls
    qanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvtd
    kaawhttrlvlehh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1otvB (B:)
    mlitdtlspqafeealrakgdfyhihhpyhiamhngdatrkqiqgwvanrfyyqttiplk
    daaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpg
    vrfavdaylnfarracwqeaacssltelfapqihqsrldswpqhypwikeegyfyfrsrl
    sqanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvt
    dkaawhttrlvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1otvB (B:)
    litdtlspqafeealrakgdfyhihhpyhiamhngdatrkqiqgwvanrfyyqttiplkd
    aaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpgv
    rfavdaylnfarracwqeaacssltelfapqihqsrldswpqhypwikeegyfyfrsrls
    qanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvtd
    kaawhttrlvlehh