PDB entry 1ott

View 1ott on RCSB PDB site
Description: Structure of the Escherichia coli ClC Chloride channel E148A mutant and Fab Complex
Class: membrane protein
Keywords: chloride channel, Fab complex, ion channel, MEMBRANE PROTEIN
Deposited on 2003-03-23, released 2003-04-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.296
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Voltage-gated ClC-type chloride channel eriC
    Species: Escherichia coli [TaxId:562]
    Gene: ERIC OR B0155
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37019
      • engineered (147)
    Domains in SCOPe 2.03: d1otta_
  • Chain 'B':
    Compound: Voltage-gated ClC-type chloride channel eriC
    Species: Escherichia coli [TaxId:562]
    Gene: ERIC OR B0155
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37019
      • engineered (147)
    Domains in SCOPe 2.03: d1ottb_
  • Chain 'C':
    Compound: Fab Fragment (Heavy Chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OTT (Start-221)
    Domains in SCOPe 2.03: d1ottc1, d1ottc2
  • Chain 'D':
    Compound: Fab Fragment (Light Chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OTT (0-210)
    Domains in SCOPe 2.03: d1ottd1, d1ottd2
  • Chain 'E':
    Compound: Fab Fragment (Heavy Chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OTT (Start-221)
    Domains in SCOPe 2.03: d1otte1, d1otte2
  • Chain 'F':
    Compound: Fab Fragment (Light Chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OTT (0-210)
    Domains in SCOPe 2.03: d1ottf1, d1ottf2
  • Heterogens: CL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ottA (A:)
    mktdtpsletpqaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawl
    qnqrmgalvhtadnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqr
    pvrwwrvlpvkffgglgtlgggmvlgragptvqiggnigrmvldifrlkgdearhtllat
    gaaaglaaafnaplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalid
    vgklsdaplntlwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigg
    lcgllgfvapatsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapm
    lalgtvlgtafgmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyq
    lilpmiitglgatllaqftggkplysailartlakqeaeqlarsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ottA (A:)
    rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
    llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
    gtlgggmvlgragptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
    ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
    ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
    fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
    elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
    qftggkplysailartlakqeaeq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ottB (B:)
    mktdtpsletpqaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawl
    qnqrmgalvhtadnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqr
    pvrwwrvlpvkffgglgtlgggmvlgragptvqiggnigrmvldifrlkgdearhtllat
    gaaaglaaafnaplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalid
    vgklsdaplntlwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigg
    lcgllgfvapatsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapm
    lalgtvlgtafgmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyq
    lilpmiitglgatllaqftggkplysailartlakqeaeqlarsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ottB (B:)
    rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl
    lltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglg
    tlgggmvlgragptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi
    lfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyli
    lgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggf
    nlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvave
    lfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatllaq
    ftggkplysailartlakqea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ottC (C:)
    evrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstiny
    tpslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvs
    sakttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqa
    alytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ottC (C:)
    vrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstinyt
    pslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvss
    akttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqaa
    lytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ottD (D:)
    divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
    fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnra
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ottE (E:)
    evrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstiny
    tpslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvs
    sakttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqa
    alytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ottE (E:)
    vrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstinyt
    pslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvss
    akttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqaa
    lytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ottF (F:)
    divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
    fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnra