PDB entry 1ots

View 1ots on RCSB PDB site
Description: Structure of the Escherichia coli ClC Chloride channel and Fab Complex
Class: membrane protein
Keywords: ClC Chloride channel, Fab complex, MEMBRANE PROTEIN
Deposited on 2003-03-22, released 2003-04-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.264
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Voltage-gated ClC-type chloride channel eriC
    Species: Escherichia coli [TaxId:562]
    Gene: ERIC OR B0155
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1otsa_
  • Chain 'B':
    Compound: Voltage-gated ClC-type chloride channel eriC
    Species: Escherichia coli [TaxId:562]
    Gene: ERIC OR B0155
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1otsb_
  • Chain 'C':
    Compound: Fab Fragment (Heavy Chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OTS (Start-221)
    Domains in SCOPe 2.06: d1otsc1, d1otsc2
  • Chain 'D':
    Compound: Fab Fragment (Light Chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OTS (0-210)
    Domains in SCOPe 2.06: d1otsd1, d1otsd2
  • Chain 'E':
    Compound: Fab Fragment (Heavy Chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OTS (Start-221)
    Domains in SCOPe 2.06: d1otse1, d1otse2
  • Chain 'F':
    Compound: Fab Fragment (Light Chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OTS (0-210)
    Domains in SCOPe 2.06: d1otsf1, d1otsf2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1otsA (A:)
    mktdtpsletpqaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawl
    qnqrmgalvhtadnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqr
    pvrwwrvlpvkffgglgtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllat
    gaaaglaaafnaplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalid
    vgklsdaplntlwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigg
    lcgllgfvapatsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapm
    lalgtvlgtafgmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyq
    lilpmiitglgatllaqftggkplysailartlakqeaeqlarsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1otsA (A:)
    rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
    llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
    gtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
    ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
    ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
    fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
    elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
    qftggkplysailartlakqeaeq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1otsB (B:)
    mktdtpsletpqaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawl
    qnqrmgalvhtadnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqr
    pvrwwrvlpvkffgglgtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllat
    gaaaglaaafnaplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalid
    vgklsdaplntlwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigg
    lcgllgfvapatsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapm
    lalgtvlgtafgmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyq
    lilpmiitglgatllaqftggkplysailartlakqeaeqlarsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1otsB (B:)
    rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl
    lltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglg
    tlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi
    lfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyli
    lgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggf
    nlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvave
    lfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatllaq
    ftggkplysailartlakqea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1otsC (C:)
    evrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstiny
    tpslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvs
    sakttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqa
    alytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1otsC (C:)
    vrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstinyt
    pslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvss
    akttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqaa
    lytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1otsD (D:)
    divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
    fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnra
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1otsE (E:)
    evrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstiny
    tpslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvs
    sakttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqa
    alytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1otsE (E:)
    vrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstinyt
    pslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvss
    akttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqaa
    lytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1otsF (F:)
    divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
    fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnra