PDB entry 1otr

View 1otr on RCSB PDB site
Description: Solution Structure of a CUE-Ubiquitin Complex
Class: cell cycle
Keywords: protein-protein complex, cell cycle
Deposited on 2003-03-22, released 2003-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein Cue2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CUE2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1otra_
  • Chain 'B':
    Compound: Ubiquitin
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: UBI1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1otrb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1otrA (A:)
    nddhesklsilmdmfpaisksklqvhllennndldltiglllkenddks
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1otrB (B:)
    mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg