PDB entry 1otr

View 1otr on RCSB PDB site
Description: Solution Structure of a CUE-Ubiquitin Complex
Class: cell cycle
Keywords: protein-protein complex
Deposited on 2003-03-22, released 2003-06-24
The last revision prior to the SCOP 1.73 freeze date was dated 2003-06-24, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein Cue2
    Species: Saccharomyces cerevisiae
    Gene: CUE2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1otra_
  • Chain 'B':
    Compound: Ubiquitin
    Species: Saccharomyces cerevisiae
    Gene: UBI1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1otrb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1otrA (A:)
    nddhesklsilmdmfpaisksklqvhllennndldltiglllkenddks
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1otrB (B:)
    mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg