PDB entry 1otk

View 1otk on RCSB PDB site
Description: Structural Genomics, Protein paaC
Class: oxidoreductase
Keywords: STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, OXIDOREDUCTASE
Deposited on 2003-03-21, released 2003-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phenylacetic acid degradation protein paaC
    Species: Escherichia coli [TaxId:83333]
    Gene: PAAC OR B1390
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76079 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1otka1, d1otka2
  • Chain 'B':
    Compound: Phenylacetic acid degradation protein paaC
    Species: Escherichia coli [TaxId:83333]
    Gene: PAAC OR B1390
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76079 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1otkb1, d1otkb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1otkA (A:)
    hgnqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaael
    agegdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpql
    aaisakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidial
    seegiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqyl
    qrvlpgqqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1otkA (A:)
    hgnqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaael
    agegdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpql
    aaisakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidial
    seegiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqyl
    qrvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1otkB (B:)
    hgnqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaael
    agegdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpql
    aaisakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidial
    seegiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqyl
    qrvlpgqqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1otkB (B:)
    hgnqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaael
    agegdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpql
    aaisakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidial
    seegiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqyl
    qrvl