PDB entry 1oth

View 1oth on RCSB PDB site
Description: crystal structure of human ornithine transcarbamoylase complexed with n-phosphonacetyl-l-ornithine
Class: transferase
Keywords: transcarbamoylase, transferase
Deposited on 1998-10-06, released 1999-10-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.179
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ornithine transcarbamoylase)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00480 (0-320)
      • conflict (67)
      • conflict (236)
    Domains in SCOPe 2.08: d1otha1, d1otha2
  • Heterogens: PAO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1othA (A:)
    kvqlkgrdlltlknftgeeikymlwlsadlkfrikqkgeylpllqgkslgmifekrstrt
    rlstetgfallgghpcflttqdihlgvnesltdtarvlssmadavlarvykqsdldtlak
    easipiinglsdlyhpiqiladyltlqehysslkgltlswigdgnnilhsimmsaakfgm
    hlqaatpkgyepdasvtklaeqyakengtkllltndpleaahggnvlitdtwismgreee
    kkkrlqafqgyqvtmktakvaasdwtflhclprkpeevddevfysprslvfpeaenrkwt
    imavmvslltdyspqlqkpkf